Lineage for d1ngaa1 (1nga A:4-188)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 835947Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 836126Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 836127Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 836180Domain d1ngaa1: 1nga A:4-188 [33407]

Details for d1ngaa1

PDB Entry: 1nga (more details), 2.18 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment
PDB Compounds: (A:) heat-shock cognate 70 kd protein

SCOP Domain Sequences for d1ngaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngaa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriinsptaaaiay
gldkk

SCOP Domain Coordinates for d1ngaa1:

Click to download the PDB-style file with coordinates for d1ngaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ngaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngaa2