Lineage for d5vh5a2 (5vh5 A:343-447)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752380Domain d5vh5a2: 5vh5 A:343-447 [334064]
    automated match to d4dz8a2
    complexed with act, zn

Details for d5vh5a2

PDB Entry: 5vh5 (more details), 1.75 Å

PDB Description: crystal structure of fc fragment of anti-tnfa antibody infliximab
PDB Compounds: (A:) Infliximab Fc

SCOPe Domain Sequences for d5vh5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vh5a2 b.1.1.2 (A:343-447) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOPe Domain Coordinates for d5vh5a2:

Click to download the PDB-style file with coordinates for d5vh5a2.
(The format of our PDB-style files is described here.)

Timeline for d5vh5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5vh5a1