SCOPe 2.06: Domain d5v4md2: 5v4m D:82-181

Lineage for d5v4md2 (5v4m D:82-181)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5v4md2: 5v4m D:82-181 [334044]
   Other proteins in same PDB: d5v4ma1, d5v4md1, d5v4mg1, d5v4mj1
   automated match to d1ieaa1
   complexed with fuc, nag

Details for d5v4md2

PDB Entry: 5v4m, 2.1 Å

PDB Description: structure of hla-dr15 with bound alpha3(135-145) peptide

PDB Compounds: (D:) hla-dra1

SCOPe Domain Sequences for d5v4md2:

Sequence; same for both SEQRES and ATOM records:

>d5v4md2 b.1.1.0 (D:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d5v4md2:

• d5v4md2 is new in SCOPe 2.06-stable
  
• d5v4md2 appears in SCOPe 2.07
  
• d5v4md2 appears in the current release, SCOPe 2.08