Lineage for d5vh4b1 (5vh4 B:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760054Domain d5vh4b1: 5vh4 B:1-106 [334022]
    Other proteins in same PDB: d5vh4a_, d5vh4b2, d5vh4h_, d5vh4l2
    automated match to d1dn0a1
    complexed with edo, nad

Details for d5vh4b1

PDB Entry: 5vh4 (more details), 2 Å

PDB Description: crystal structure of fab fragment of anti-tnfa antibody infliximab in an i-centered orthorhombic crystal form
PDB Compounds: (B:) Infliximab Fab Light Chain

SCOPe Domain Sequences for d5vh4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vh4b1 b.1.1.0 (B:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspailsvspgervsfscrasqfvgssihwyqqrtngsprllikyasesmsgips
rfsgsgsgtdftlsintvesediadyycqqshswpftfgsgtnlev

SCOPe Domain Coordinates for d5vh4b1:

Click to download the PDB-style file with coordinates for d5vh4b1.
(The format of our PDB-style files is described here.)

Timeline for d5vh4b1: