SCOP 1.67: Domain d1ngb_2: 1ngb 189-381

Lineage for d1ngb_2 (1ngb 189-381)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1ngb_2: 1ngb 189-381 [33402]
   complexed with adp, mg, po4; mutant

Details for d1ngb_2

PDB Entry: 1ngb, 2.38 Å

PDB Description: structural basis of the 70-kilodalton heat shock cognate protein atp hydrolytic activity, ii. structure of the active site with adp or atp bound to wild type and mutant atpase fragment

SCOP Domain Sequences for d1ngb_2:

Sequence; same for both SEQRES and ATOM records:

>d1ngb_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d1ngb_2:

• d1ngb_2 first appeared (with stable ids) in SCOP 1.55
  
• d1ngb_2 appears in SCOP 1.65
  
• d1ngb_2 appears in SCOP 1.69
  
• d1ngb_2 appears in the current release, SCOPe 2.08, called d1ngba2