Lineage for d5twjd1 (5twj D:2-155)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921250Family c.116.1.3: YbeA-like [82371] (5 proteins)
    Pfam PF02590
  6. 2921276Protein automated matches [195222] (2 species)
    not a true protein
  7. 2921277Species Escherichia coli [TaxId:562] [333863] (2 PDB entries)
  8. 2921285Domain d5twjd1: 5twj D:2-155 [334016]
    Other proteins in same PDB: d5twja2, d5twjb2, d5twjc2, d5twjd2
    automated match to d1ns5b_
    protein/RNA complex; complexed with sam

Details for d5twjd1

PDB Entry: 5twj (more details), 2.3 Å

PDB Description: crystal structure of rlmh in complex with s-adenosylmethionine
PDB Compounds: (D:) Ribosomal RNA large subunit methyltransferase H

SCOPe Domain Sequences for d5twjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5twjd1 c.116.1.3 (D:2-155) automated matches {Escherichia coli [TaxId: 562]}
klqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqml
aaagknrivtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqsws
lsaltlphplvrvlvaeslyrawsittnhpyhre

SCOPe Domain Coordinates for d5twjd1:

Click to download the PDB-style file with coordinates for d5twjd1.
(The format of our PDB-style files is described here.)

Timeline for d5twjd1: