SCOPe 2.08: Domain d5vice_: 5vic E:

Lineage for d5vice_ (5vic E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus type 1 (strain nauru/west pac/1974) [TaxId:11059] [334000] (1 PDB entry)

8. Domain d5vice_: 5vic E: [334001]
   Other proteins in same PDB: d5vich_, d5vicl1, d5vicl2
   automated match to d3egpa_

Details for d5vice_

PDB Entry: 5vic, 3 Å

PDB Description: crystal structure of anti-zika antibody z004 bound to denv-1 envelope protein diii

PDB Compounds: (E:) Dengue 1 Envelope DIII domain

SCOPe Domain Sequences for d5vice_:

Sequence, based on SEQRES records:

>d5vice_ b.1.18.0 (E:) automated matches {Dengue virus type 1 (strain nauru/west pac/1974) [TaxId: 11059]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswf

Sequence, based on observed residues (ATOM records):

>d5vice_ b.1.18.0 (E:) automated matches {Dengue virus type 1 (strain nauru/west pac/1974) [TaxId: 11059]}
syvmctgsfklekevaegtvlvqvkyegtdapckipfssqngrlitanpivtdkekpvni
eaeppesyivvgagekalklswf

Timeline for d5vice_:

• d5vice_ first appeared in SCOPe 2.06
  
• d5vice_ appears in SCOPe 2.07