Lineage for d5v2kb_ (5v2k B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911283Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256209] (9 PDB entries)
  8. 2911295Domain d5v2kb_: 5v2k B: [333990]
    automated match to d2pq6a1
    complexed with 7wv, bgc, udp

Details for d5v2kb_

PDB Entry: 5v2k (more details), 2 Å

PDB Description: crystal structure of udp-glucosyltransferase, ugt74f2 (t15a), with udp and 2-bromobenzoic acid
PDB Compounds: (B:) UDP-glycosyltransferase 74F2

SCOPe Domain Sequences for d5v2kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v2kb_ c.87.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krghvlavpypaqghitpfrqfckrlhfkglkttlalttfvfnsinpdlsgpisiatisd
gydhggfetadsiddylkdfktsgsktiadiiqkhqtsdnpitcivydaflpwaldvare
fglvatpfftqpcavnyvyylsyinngslqlpieelpflelqdlpsffsvsgsypayfem
vlqqfinfekadfvlvnsfqelelhenelwskacpvltigptipsiyldqriksdtgydl
nlfeskddsfcinwldtrpqgsvvyvafgsmaqltnvqmeelasavsnfsflwvvrssee
eklpsgfletvnkekslvlkwspqlqvlsnkaigcflthcgwnstmealtfgvpmvampq
wtdqpmnakyiqdvwkagvrvktekesgiakreeiefsikevmegerskemkknvkkwrd
lavkslneggstdtnidtfvsrvq

SCOPe Domain Coordinates for d5v2kb_:

Click to download the PDB-style file with coordinates for d5v2kb_.
(The format of our PDB-style files is described here.)

Timeline for d5v2kb_: