SCOPe 2.08: Domain d5vcpd_: 5vcp D:

Lineage for d5vcpd_ (5vcp D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Paraburkholderia xenovorans [TaxId:266265] [333971] (1 PDB entry)

8. Domain d5vcpd_: 5vcp D: [333972]
   automated match to d3dlda_
   complexed with bb2, fe2, mg

Details for d5vcpd_

PDB Entry: 5vcp, 1.95 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia xenovorans in complex with actinonin

PDB Compounds: (D:) Peptide deformylase

SCOPe Domain Sequences for d5vcpd_:

Sequence, based on SEQRES records:

>d5vcpd_ d.167.1.0 (D:) automated matches {Paraburkholderia xenovorans [TaxId: 266265]}
mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
fgfghnerypdappvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgf
dqygkpidrvaegfharvvqhecdhligklypmrindfakfgftevlfp

Sequence, based on observed residues (ATOM records):

>d5vcpd_ d.167.1.0 (D:) automated matches {Paraburkholderia xenovorans [TaxId: 266265]}
mireilkmgdprllriadpvdhfdtpelhelvkdmfetmhdangaglaapqigvnlqvvi
fgfpvpetvlinptitpvsqdmeegwegclsvpglrgavsrfsmikyhgfdqygkpidrv
aegfharvvqhecdhligklypmrindfakfgftevlfp

Timeline for d5vcpd_:

• d5vcpd_ first appeared in SCOPe 2.06
  
• d5vcpd_ appears in SCOPe 2.07