SCOPe 2.06: Domain d5vcub1: 5vcu B:2-183

Lineage for d5vcub1 (5vcu B:2-183)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Naegleria fowleri [TaxId:5763] [333965] (1 PDB entry)

8. Domain d5vcub1: 5vcu B:2-183 [333966]
   Other proteins in same PDB: d5vcua2, d5vcub2
   automated match to d2rmka_
   complexed with gdp, mg

Details for d5vcub1

PDB Entry: 5vcu, 1.85 Å

PDB Description: crystal structure of ras-related c3 botulinum toxin substrate 1 isoform x2 from naegleria fowleri in complex with gdp

PDB Compounds: (B:) Ras-related c3 botulinum toxin substrate 1 isoform x2

SCOPe Domain Sequences for d5vcub1:

Sequence; same for both SEQRES and ATOM records:

>d5vcub1 c.37.1.0 (B:2-183) automated matches {Naegleria fowleri [TaxId: 5763]}
esikcvvvgdgavgktalliayssgcfpedyvptvfdnynknipygdgivsialydtagq
edydrlrplsypdtdvflvcfslenpnslenchskwaeelkhynpdtpivlvgtkldlkk
deeyvkklkekkispvtteqgqemkdkikacgyiecsaktmenlteafnmaidiamkqrl
kd

Timeline for d5vcub1:

• d5vcub1 is new in SCOPe 2.06-stable
  
• d5vcub1 appears in SCOPe 2.07
  
• d5vcub1 appears in the current release, SCOPe 2.08