Lineage for d5m5eb2 (5m5e B:104-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2036010Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2036011Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2036017Domain d5m5eb2: 5m5e B:104-208 [333950]
    Other proteins in same PDB: d5m5ec1, d5m5ec2, d5m5ed_
    automated match to d4gs7b2
    complexed with cys, fuc, man, nag, so4

Details for d5m5eb2

PDB Entry: 5m5e (more details), 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
PDB Compounds: (B:) Interleukin-2 receptor subunit beta

SCOPe Domain Sequences for d5m5eb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m5eb2 b.1.2.1 (B:104-208) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkpa

SCOPe Domain Coordinates for d5m5eb2:

Click to download the PDB-style file with coordinates for d5m5eb2.
(The format of our PDB-style files is described here.)

Timeline for d5m5eb2: