SCOPe 2.08: Domain d5m5eb2: 5m5e B:104-208

Lineage for d5m5eb2 (5m5e B:104-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Interleukin-2 receptor beta chain [141047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
   Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129

8. Domain d5m5eb2: 5m5e B:104-208 [333950]
   Other proteins in same PDB: d5m5ec1, d5m5ec2, d5m5ed_
   automated match to d4gs7b2
   complexed with cys, man, nag, so4

Details for d5m5eb2

PDB Entry: 5m5e, 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor

PDB Compounds: (B:) Interleukin-2 receptor subunit beta

SCOPe Domain Sequences for d5m5eb2:

Sequence; same for both SEQRES and ATOM records:

>d5m5eb2 b.1.2.1 (B:104-208) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkpa

Timeline for d5m5eb2:

• d5m5eb2 first appeared in SCOPe 2.06
  
• d5m5eb2 appears in SCOPe 2.07