Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Interleukin-2 receptor beta chain [141047] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
Domain d5m5eb1: 5m5e B:6-103 [333949] Other proteins in same PDB: d5m5ec1, d5m5ec2, d5m5ed_ automated match to d4gs7b1 complexed with cys, man, nag, so4 |
PDB Entry: 5m5e (more details), 2.3 Å
SCOPe Domain Sequences for d5m5eb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m5eb1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen
Timeline for d5m5eb1: