SCOPe 2.08: Domain d5v4mg1: 5v4m G:4-81

Lineage for d5v4mg1 (5v4m G:4-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5v4mg1: 5v4m G:4-81 [333942]
   Other proteins in same PDB: d5v4ma2, d5v4md2, d5v4mg2, d5v4mj2
   automated match to d1fnga2
   complexed with nag

Details for d5v4mg1

PDB Entry: 5v4m, 2.1 Å

PDB Description: structure of hla-dr15 with bound alpha3(135-145) peptide

PDB Compounds: (G:) hla-dra1

SCOPe Domain Sequences for d5v4mg1:

Sequence; same for both SEQRES and ATOM records:

>d5v4mg1 d.19.1.0 (G:4-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalani
avdkanleimtkrsnytp

Timeline for d5v4mg1:

• d5v4mg1 first appeared in SCOPe 2.06
  
• d5v4mg1 appears in SCOPe 2.07