SCOP 1.69: Domain d1qqna2: 1qqn A:189-381

Lineage for d1qqna2 (1qqn A:189-381)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1qqna2: 1qqn A:189-381 [33394]

Details for d1qqna2

PDB Entry: 1qqn, 1.9 Å

PDB Description: d206s mutant of bovine 70 kilodalton heat shock protein

SCOP Domain Sequences for d1qqna2:

Sequence; same for both SEQRES and ATOM records:

>d1qqna2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfsvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkra
hakdisenkravrrlatacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d1qqna2:

• d1qqna2 first appeared (with stable ids) in SCOP 1.55
  
• d1qqna2 appears in SCOP 1.67
  
• d1qqna2 appears in SCOP 1.71
  
• d1qqna2 appears in the current release, SCOPe 2.08