Lineage for d5tlca_ (5tlc A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424945Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2424999Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2425000Protein automated matches [190849] (8 species)
    not a true protein
  7. 2425004Species Bacillus subtilis [TaxId:1423] [333823] (1 PDB entry)
  8. 2425005Domain d5tlca_: 5tlc A: [333934]
    automated match to d1tvla_

Details for d5tlca_

PDB Entry: 5tlc (more details), 2.8 Å

PDB Description: crystal structure of bdsa from bacillus subtilis wu-s2b
PDB Compounds: (A:) Dibenzothiophene desulfurization enzyme A

SCOPe Domain Sequences for d5tlca_:

Sequence, based on SEQRES records: (download)

>d5tlca_ c.1.16.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaied
sygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatld
nlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedallld
kvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeav
fsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvh
pevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlaelg
rrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllqq
rgvfrteyegttlrehlglah

Sequence, based on observed residues (ATOM records): (download)

>d5tlca_ c.1.16.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
qlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaied
snletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatldnls
dgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedallldkvg
grfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaeavfsv
spnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslvhpev
glstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlaelgrry
gtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllqqrgv
frteyegttlrehlglah

SCOPe Domain Coordinates for d5tlca_:

Click to download the PDB-style file with coordinates for d5tlca_.
(The format of our PDB-style files is described here.)

Timeline for d5tlca_: