SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1qqna1 (1qqn A:4-188)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122311Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 2122312Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 2122345Domain d1qqna1: 1qqn A:4-188 [33393]
    complexed with adp, cl, k, mg, po4; mutant

Details for d1qqna1

PDB Entry: 1qqn (more details), 1.9 Å

PDB Description: d206s mutant of bovine 70 kilodalton heat shock protein
PDB Compounds: (A:) d206s mutant of bovine 70 kilodalton heat shock protein

SCOPe Domain Sequences for d1qqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqna1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrafddavvqsdmkhwpfmvvndagapkvqveykgetksfypeevssmv
ltkmkeiaeaylgatvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldka

SCOPe Domain Coordinates for d1qqna1:

Click to download the PDB-style file with coordinates for d1qqna1.
(The format of our PDB-style files is described here.)

Timeline for d1qqna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qqna2