SCOP 1.73: Domain d1qqma2: 1qqm A:189-381

Lineage for d1qqma2 (1qqm A:189-381)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (26 PDB entries)

8. Domain d1qqma2: 1qqm A:189-381 [33392]
   complexed with adp, cl, k, mg, pi; mutant

Details for d1qqma2

PDB Entry: 1qqm, 1.9 Å

PDB Description: d199s mutant of bovine 70 kilodalton heat shock protein

PDB Compounds: (A:) d199s mutant of bovine 70 kilodalton heat shock protein

SCOP Domain Sequences for d1qqma2:

Sequence; same for both SEQRES and ATOM records:

>d1qqma2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
vgaernvlifslgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkra
hakdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d1qqma2:

• d1qqma2 first appeared (with stable ids) in SCOP 1.55
  
• d1qqma2 appears in SCOP 1.71
  
• d1qqma2 appears in SCOP 1.75
  
• d1qqma2 appears in the current release, SCOPe 2.08