Lineage for d1kax_1 (1kax 4-188)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397316Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 397317Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 397404Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 397405Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 397418Domain d1kax_1: 1kax 4-188 [33389]

Details for d1kax_1

PDB Entry: 1kax (more details), 1.7 Å

PDB Description: 70kd heat shock cognate protein atpase domain, k71m mutant

SCOP Domain Sequences for d1kax_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kax_1 c.55.1.1 (4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdamrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOP Domain Coordinates for d1kax_1:

Click to download the PDB-style file with coordinates for d1kax_1.
(The format of our PDB-style files is described here.)

Timeline for d1kax_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kax_2