SCOPe 2.08: Domain d5m63n1: 5m63 N:24-134

Lineage for d5m63n1 (5m63 N:24-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d5m63n1: 5m63 N:24-134 [333869]
   automated match to d4jo4l1
   complexed with 7gw, edo

Details for d5m63n1

PDB Entry: 5m63, 2.74 Å

PDB Description: crystal structure of group b streptococcus type iii dp2 oligosaccharide bound to fab nvs-1-19-5

PDB Compounds: (N:) L chain of Fab NVS-1-19-5

SCOPe Domain Sequences for d5m63n1:

Sequence; same for both SEQRES and ATOM records:

>d5m63n1 b.1.1.0 (N:24-134) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vvltqtpssvsaavggsvtiscqssqslynnnrlawyqqkagqppklliykastlesgvp
srfkgsgagtqftltisdvvcddaatyycagyksnsddgtafgggtevvvk

Timeline for d5m63n1:

• d5m63n1 first appeared in SCOPe 2.06
  
• d5m63n1 appears in SCOPe 2.07