| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries) |
| Domain d1kay_2: 1kay 189-381 [33386] |
PDB Entry: 1kay (more details), 1.7 Å
SCOP Domain Sequences for d1kay_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kay_2 c.55.1.1 (189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
Timeline for d1kay_2: