Lineage for d5tl7a_ (5tl7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933417Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries)
  8. 2933465Domain d5tl7a_: 5tl7 A: [333852]
    Other proteins in same PDB: d5tl7b2, d5tl7b3, d5tl7d2
    automated match to d3phxb_
    complexed with zn

Details for d5tl7a_

PDB Entry: 5tl7 (more details), 2.44 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with c- terminal domain mouse isg15
PDB Compounds: (A:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d5tl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl7a_ d.15.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
plsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellgey
glkpqctvikhlrlrgx

SCOPe Domain Coordinates for d5tl7a_:

Click to download the PDB-style file with coordinates for d5tl7a_.
(The format of our PDB-style files is described here.)

Timeline for d5tl7a_: