![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (31 species) not a true protein |
![]() | Species Human sars coronavirus [TaxId:227859] [333835] (3 PDB entries) |
![]() | Domain d5tl6b1: 5tl6 B:2-62 [333840] Other proteins in same PDB: d5tl6b2, d5tl6d2 automated match to d3e9sa1 complexed with so4, zn |
PDB Entry: 5tl6 (more details), 2.62 Å
SCOPe Domain Sequences for d5tl6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tl6b1 d.15.1.0 (B:2-62) automated matches {Human sars coronavirus [TaxId: 227859]} evktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlps d
Timeline for d5tl6b1:
![]() Domains from other chains: (mouse over for more information) d5tl6a_, d5tl6c_, d5tl6d1, d5tl6d2 |