![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
![]() | Protein automated matches [310868] (6 species) not a true protein |
![]() | Species Human sars coronavirus [TaxId:227859] [333837] (3 PDB entries) |
![]() | Domain d5tl6d2: 5tl6 D:63-316 [333838] Other proteins in same PDB: d5tl6a_, d5tl6b1, d5tl6c_, d5tl6d1 automated match to d2fe8a2 complexed with so4, zn |
PDB Entry: 5tl6 (more details), 2.62 Å
SCOPe Domain Sequences for d5tl6d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tl6d2 d.3.1.23 (D:63-316) automated matches {Human sars coronavirus [TaxId: 227859]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsytttik
Timeline for d5tl6d2:
![]() Domains from other chains: (mouse over for more information) d5tl6a_, d5tl6b1, d5tl6b2, d5tl6c_ |