Lineage for d5tl6d2 (5tl6 D:63-316)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927545Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
    C-terminal part of Pfam PF08715
  6. 2927569Protein automated matches [310868] (6 species)
    not a true protein
  7. 2927575Species Human sars coronavirus [TaxId:227859] [333837] (3 PDB entries)
  8. 2927579Domain d5tl6d2: 5tl6 D:63-316 [333838]
    Other proteins in same PDB: d5tl6a_, d5tl6b1, d5tl6c_, d5tl6d1
    automated match to d2fe8a2
    complexed with so4, zn

Details for d5tl6d2

PDB Entry: 5tl6 (more details), 2.62 Å

PDB Description: crystal structure of sars-cov papain-like protease in complex with the c-terminal domain of human isg15
PDB Compounds: (D:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d5tl6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl6d2 d.3.1.23 (D:63-316) automated matches {Human sars coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttik

SCOPe Domain Coordinates for d5tl6d2:

Click to download the PDB-style file with coordinates for d5tl6d2.
(The format of our PDB-style files is described here.)

Timeline for d5tl6d2: