SCOPe 2.08: Domain d5m63l2: 5m63 L:135-238

Lineage for d5m63l2 (5m63 L:135-238)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d5m63l2: 5m63 L:135-238 [333833]
   automated match to d4ztpl2
   complexed with 7gw, edo

Details for d5m63l2

PDB Entry: 5m63, 2.74 Å

PDB Description: crystal structure of group b streptococcus type iii dp2 oligosaccharide bound to fab nvs-1-19-5

PDB Compounds: (L:) L chain of Fab NVS-1-19-5

SCOPe Domain Sequences for d5m63l2:

Sequence; same for both SEQRES and ATOM records:

>d5m63l2 b.1.1.0 (L:135-238) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqns
adctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc

Timeline for d5m63l2:

• d5m63l2 first appeared in SCOPe 2.06
  
• d5m63l2 appears in SCOPe 2.07