Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
Domain d5m63l2: 5m63 L:135-238 [333833] automated match to d4ztpl2 complexed with 7gw, edo |
PDB Entry: 5m63 (more details), 2.74 Å
SCOPe Domain Sequences for d5m63l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m63l2 b.1.1.0 (L:135-238) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gdpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqns adctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc
Timeline for d5m63l2: