Lineage for d5m63l1 (5m63 L:24-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761479Domain d5m63l1: 5m63 L:24-134 [333832]
    automated match to d4jo4l1
    complexed with 7gw, edo

Details for d5m63l1

PDB Entry: 5m63 (more details), 2.74 Å

PDB Description: crystal structure of group b streptococcus type iii dp2 oligosaccharide bound to fab nvs-1-19-5
PDB Compounds: (L:) L chain of Fab NVS-1-19-5

SCOPe Domain Sequences for d5m63l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m63l1 b.1.1.0 (L:24-134) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vvltqtpssvsaavggsvtiscqssqslynnnrlawyqqkagqppklliykastlesgvp
srfkgsgagtqftltisdvvcddaatyycagyksnsddgtafgggtevvvk

SCOPe Domain Coordinates for d5m63l1:

Click to download the PDB-style file with coordinates for d5m63l1.
(The format of our PDB-style files is described here.)

Timeline for d5m63l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5m63l2