| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (22 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
| Domain d5tl6a_: 5tl6 A: [333830] Other proteins in same PDB: d5tl6b2, d5tl6d2 automated match to d3phxb_ complexed with so4, zn |
PDB Entry: 5tl6 (more details), 2.62 Å
SCOPe Domain Sequences for d5tl6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tl6a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eplsilvrnnkgrsstyevrltqtvahlkqqvsglegvqddlfwltfegkpledqlplge
yglkplstvfmnlrlrgx
Timeline for d5tl6a_: