Lineage for d1kaza1 (1kaz A:4-188)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372597Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1372598Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 1372609Domain d1kaza1: 1kaz A:4-188 [33383]
    complexed with atp, cl, k, mg; mutant

Details for d1kaza1

PDB Entry: 1kaz (more details), 1.7 Å

PDB Description: 70kd heat shock cognate protein atpase domain, k71e mutant
PDB Compounds: (A:) 70kd heat shock cognate protein

SCOPe Domain Sequences for d1kaza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kaza1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdaerligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiay
gldkk

SCOPe Domain Coordinates for d1kaza1:

Click to download the PDB-style file with coordinates for d1kaza1.
(The format of our PDB-style files is described here.)

Timeline for d1kaza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kaza2