Lineage for d5nqbd1 (5nqb D:1-159)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105961Protein automated matches [226881] (5 species)
    not a true protein
  7. 2106014Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (8 PDB entries)
  8. 2106018Domain d5nqbd1: 5nqb D:1-159 [333821]
    Other proteins in same PDB: d5nqba2, d5nqbb2, d5nqbc2, d5nqbd2
    automated match to d4i9ha1
    complexed with mli

Details for d5nqbd1

PDB Entry: 5nqb (more details), 1.58 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with malonate
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqbd1 c.2.1.5 (D:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5nqbd1:

Click to download the PDB-style file with coordinates for d5nqbd1.
(The format of our PDB-style files is described here.)

Timeline for d5nqbd1: