Lineage for d5jo7b2 (5jo7 B:228-555)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337790Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 protein domains)
    automatically mapped to Pfam PF03936
  6. 2337815Protein automated matches [227033] (2 species)
    not a true protein
  7. 2337816Species Hyoscyamus muticus [TaxId:35626] [333735] (1 PDB entry)
  8. 2337818Domain d5jo7b2: 5jo7 B:228-555 [333820]
    Other proteins in same PDB: d5jo7a1, d5jo7b1, d5jo7c1, d5jo7d1
    automated match to d3m00a2

Details for d5jo7b2

PDB Entry: 5jo7 (more details), 2.15 Å

PDB Description: henbane premnaspirodiene synthase (hps), also known as henbane vetispiradiene synthase (hvs) from hyoscyamus muticus
PDB Compounds: (B:) Vetispiradiene synthase 1

SCOPe Domain Sequences for d5jo7b2:

Sequence, based on SEQRES records: (download)

>d5jo7b2 a.128.1.3 (B:228-555) automated matches {Hyoscyamus muticus [TaxId: 35626]}
kndlllrfakldynllqmlhkhelsevsrwwkdldfvttlpyardravecyfwtmgvyae
pqysqarvmlaktiamisivddtfdaygivkelevytdaiqrwdisqidrlpeymkisyk
alldlyddyekelskdgrsdvvhyakermkeivrnyfieakwfiegympsvseylsnala
tstyylltttsylgmksatkehfewlatnpkileanatlcrvvddiatyevekgrgqiat
giecymrdygvstevamekfqemadiawkdvneeilrptpvsseiltrilnlariidvty
khnqdgythpekvlkphiialvvdsidi

Sequence, based on observed residues (ATOM records): (download)

>d5jo7b2 a.128.1.3 (B:228-555) automated matches {Hyoscyamus muticus [TaxId: 35626]}
kndlllrfakldynllqmlhkhelsevsrwwkdldfvttlpyardravecyfwtmgvyae
pqysqarvmlaktiamisivddtfdaygivkelevytdaiqrwdisqidrlpeymkisyk
alldlyddyekelskdgrsdvvhyakermkeivrnyfieakwfiegympsvseylsnala
tstyylltttsylgmksatkehfewlatnpkileanatlcrvvddiatyevqiatgiecy
mrdygvstevamekfqemadiawkdvneeilrptpvsseiltrilnlariidvtykhpek
vlkphiialvvdsidi

SCOPe Domain Coordinates for d5jo7b2:

Click to download the PDB-style file with coordinates for d5jo7b2.
(The format of our PDB-style files is described here.)

Timeline for d5jo7b2: