SCOPe 2.06: Domain d5jo7b1: 5jo7 B:38-227

Lineage for d5jo7b1 (5jo7 B:38-227)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (9 species)
   not a true protein

7. Species Hyoscyamus muticus [TaxId:35626] [333733] (1 PDB entry)

8. Domain d5jo7b1: 5jo7 B:38-227 [333819]
   Other proteins in same PDB: d5jo7a2, d5jo7b2, d5jo7c2, d5jo7d2
   automated match to d3lz9a1

Details for d5jo7b1

PDB Entry: 5jo7, 2.15 Å

PDB Description: henbane premnaspirodiene synthase (hps), also known as henbane vetispiradiene synthase (hvs) from hyoscyamus muticus

PDB Compounds: (B:) Vetispiradiene synthase 1

SCOPe Domain Sequences for d5jo7b1:

Sequence; same for both SEQRES and ATOM records:

>d5jo7b1 a.102.4.0 (B:38-227) automated matches {Hyoscyamus muticus [TaxId: 35626]}
nqvaekyaqeietlkeqtstmlsaacgttlteklnlidiierlgiayhfekqiedmldhi
yradpyfeaheyndlntssvqfrllrqhgynvspnifsrfqdangkfkeslrsdirglln
lyeashvrthkedileealvfsvghlesaaphlksplskqvthaleqslhksiprveiry
fisiyeeeef

Timeline for d5jo7b1:

• d5jo7b1 is new in SCOPe 2.06-stable
  
• d5jo7b1 appears in SCOPe 2.07
  
• d5jo7b1 appears in the current release, SCOPe 2.08