| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.0: automated matches [227201] (1 protein) not a true family |
| Protein automated matches [226931] (12 species) not a true protein |
| Species Hyoscyamus muticus [TaxId:35626] [333733] (1 PDB entry) |
| Domain d5jo7b1: 5jo7 B:38-227 [333819] Other proteins in same PDB: d5jo7a2, d5jo7b2, d5jo7c2, d5jo7d2 automated match to d3lz9a1 |
PDB Entry: 5jo7 (more details), 2.15 Å
SCOPe Domain Sequences for d5jo7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jo7b1 a.102.4.0 (B:38-227) automated matches {Hyoscyamus muticus [TaxId: 35626]}
nqvaekyaqeietlkeqtstmlsaacgttlteklnlidiierlgiayhfekqiedmldhi
yradpyfeaheyndlntssvqfrllrqhgynvspnifsrfqdangkfkeslrsdirglln
lyeashvrthkedileealvfsvghlesaaphlksplskqvthaleqslhksiprveiry
fisiyeeeef
Timeline for d5jo7b1: