![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) ![]() |
![]() | Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
![]() | Protein automated matches [190965] (40 species) not a true protein |
![]() | Species Candida albicans [TaxId:237561] [333712] (4 PDB entries) |
![]() | Domain d5huua_: 5huu A: [333814] automated match to d2wtxb_ complexed with g6p, udp |
PDB Entry: 5huu (more details), 2.37 Å
SCOPe Domain Sequences for d5huua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huua_ c.87.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]} gkvlvvsnripvtikrldngsydysmssgglvtalqglkkttefqwygwpgleipedeqt kvndelkskfnctaiflsdtiadlhyngfsnsilwplfhyhpgemnfdenawaayieank kfaleivkqvndddmiwvhdyhlmllpemlrqeignkkknikigfflhtpfpsseiyril pvrkeilegvlscdligfhtydyarhfissvsrivpnvstlpngikyqgrsisigafpig idvdnfidglkkdsvverikqlkskfkdvkvivgvdrldyikgvpqklhafevflnenpe wigkvvlvqvavpsrgdveeyqslrstvselvgringefgtvefvpihylhksipfdeli slynisdvclvsstrdgmnlvsyeyiacqqdrkgvlilsefagaaqslngalivnpwnte dlseaikesltlpeekrefnfkklftyiskytsgfwgesfvkelykcnp
Timeline for d5huua_: