Lineage for d5nqbb1 (5nqb B:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2429134Protein Lactate dehydrogenase [51859] (19 species)
  7. 2429358Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346275] (2 PDB entries)
  8. 2429360Domain d5nqbb1: 5nqb B:1-159 [333811]
    Other proteins in same PDB: d5nqba2, d5nqbb2, d5nqbc2, d5nqbd2
    automated match to d4i9ha1
    complexed with mli

Details for d5nqbb1

PDB Entry: 5nqb (more details), 1.58 Å

PDB Description: rabbit muscle l-lactate dehydrogenase in complex with malonate
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5nqbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nqbb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5nqbb1:

Click to download the PDB-style file with coordinates for d5nqbb1.
(The format of our PDB-style files is described here.)

Timeline for d5nqbb1: