SCOPe 2.08: Domain d5m5ed_: 5m5e D:

Lineage for d5m5ed_ (5m5e D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)

8. Domain d5m5ed_: 5m5e D: [333810]
   Other proteins in same PDB: d5m5eb1, d5m5eb2, d5m5ec1, d5m5ec2
   automated match to d1irla_
   complexed with cys, man, nag, so4

Details for d5m5ed_

PDB Entry: 5m5e, 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor

PDB Compounds: (D:) interleukin-2

SCOPe Domain Sequences for d5m5ed_:

Sequence, based on SEQRES records:

>d5m5ed_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltakfampkkatelkhlqcleeel
kpleevlngaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
faqsiistlt

Sequence, based on observed residues (ATOM records):

>d5m5ed_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginntrmltakfampkkatelkhlqcleeelkpleev
lngaqshlrprdlisninvivlelkgsettfmceyadetativeflnrwitfaqsiistl
t

Timeline for d5m5ed_:

• d5m5ed_ first appeared in SCOPe 2.06
  
• d5m5ed_ appears in SCOPe 2.07