Lineage for d5m5ed_ (5m5e D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705722Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)
  8. 2705748Domain d5m5ed_: 5m5e D: [333810]
    Other proteins in same PDB: d5m5eb1, d5m5eb2, d5m5ec1, d5m5ec2
    automated match to d1irla_
    complexed with cys, man, nag, so4

Details for d5m5ed_

PDB Entry: 5m5e (more details), 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
PDB Compounds: (D:) interleukin-2

SCOPe Domain Sequences for d5m5ed_:

Sequence, based on SEQRES records: (download)

>d5m5ed_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltakfampkkatelkhlqcleeel
kpleevlngaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
faqsiistlt

Sequence, based on observed residues (ATOM records): (download)

>d5m5ed_ a.26.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginntrmltakfampkkatelkhlqcleeelkpleev
lngaqshlrprdlisninvivlelkgsettfmceyadetativeflnrwitfaqsiistl
t

SCOPe Domain Coordinates for d5m5ed_:

Click to download the PDB-style file with coordinates for d5m5ed_.
(The format of our PDB-style files is described here.)

Timeline for d5m5ed_: