Lineage for d5lmjb1 (5lmj B:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743913Domain d5lmjb1: 5lmj B:1-112 [333806]
    Other proteins in same PDB: d5lmja2, d5lmjb2, d5lmjc2, d5lmjd2
    automated match to d4w81a_
    complexed with po4

Details for d5lmjb1

PDB Entry: 5lmj (more details), 2.1 Å

PDB Description: llama nanobody porm_19
PDB Compounds: (B:) Nanobody

SCOPe Domain Sequences for d5lmjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lmjb1 b.1.1.1 (B:1-112) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
vs

SCOPe Domain Coordinates for d5lmjb1:

Click to download the PDB-style file with coordinates for d5lmjb1.
(The format of our PDB-style files is described here.)

Timeline for d5lmjb1: