Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (307 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d5nlib_: 5nli B: [333804] automated match to d2k39a_ complexed with act, edo, etf, zn; mutant |
PDB Entry: 5nli (more details), 1.53 Å
SCOPe Domain Sequences for d5nlib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nlib_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlr
Timeline for d5nlib_: