Lineage for d5nlib_ (5nli B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538652Protein Ubiquitin [54238] (9 species)
  7. 2538766Species Human (Homo sapiens) [TaxId:9606] [54239] (307 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2538834Domain d5nlib_: 5nli B: [333804]
    automated match to d2k39a_
    complexed with act, edo, etf, zn; mutant

Details for d5nlib_

PDB Entry: 5nli (more details), 1.53 Å

PDB Description: crystal structure of zn2-e16v human ubiquitin (hub) mutant adduct, from a solution 35 mm zinc acetate/10% v/v tfe/1.3 mm e16v hub
PDB Compounds: (B:) Polyubiquitin-C

SCOPe Domain Sequences for d5nlib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nlib_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlvvepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlr

SCOPe Domain Coordinates for d5nlib_:

Click to download the PDB-style file with coordinates for d5nlib_.
(The format of our PDB-style files is described here.)

Timeline for d5nlib_: