Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) |
Protein Cystathionine beta-synthase [64174] (1 species) PLP-dependent hemoprotein |
Species Human (Homo sapiens) [TaxId:9606] [64175] (3 PDB entries) |
Domain d5mmsd_: 5mms D: [333786] automated match to d1m54a_ complexed with hem, na, plp |
PDB Entry: 5mms (more details), 2.8 Å
SCOPe Domain Sequences for d5mmsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mmsd_ c.79.1.1 (D:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} rpdalsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglkce llakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrgyr ciivmpekmssekvdvlralgaeivrtptnarfdspeshvgvawrlkneipnshildqyr nasnplahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdpeg silaepeelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqegl lcggsagstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgflkee
Timeline for d5mmsd_: