Lineage for d5mmsd_ (5mms D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907393Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2907465Protein Cystathionine beta-synthase [64174] (1 species)
    PLP-dependent hemoprotein
  7. 2907466Species Human (Homo sapiens) [TaxId:9606] [64175] (3 PDB entries)
  8. 2907476Domain d5mmsd_: 5mms D: [333786]
    automated match to d1m54a_
    complexed with hem, na, plp

Details for d5mmsd_

PDB Entry: 5mms (more details), 2.8 Å

PDB Description: human cystathionine beta-synthase (cbs) p.p49l delta409-551 variant
PDB Compounds: (D:) cystathionine beta-synthase

SCOPe Domain Sequences for d5mmsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mmsd_ c.79.1.1 (D:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]}
rpdalsrctwqlgrpasesphhhtapakspkilpdilkkigdtpmvrinkigkkfglkce
llakceffnaggsvkdrislrmiedaerdgtlkpgdtiieptsgntgiglalaaavrgyr
ciivmpekmssekvdvlralgaeivrtptnarfdspeshvgvawrlkneipnshildqyr
nasnplahydttadeilqqcdgkldmlvasvgtggtitgiarklkekcpgcriigvdpeg
silaepeelnqteqttyevegigydfiptvldrtvvdkwfksndeeaftfarmliaqegl
lcggsagstvavavkaaqelqegqrcvvilpdsvrnymtkflsdrwmlqkgflkee

SCOPe Domain Coordinates for d5mmsd_:

Click to download the PDB-style file with coordinates for d5mmsd_.
(The format of our PDB-style files is described here.)

Timeline for d5mmsd_: