Lineage for d5jn9d_ (5jn9 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2421957Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (10 PDB entries)
  8. 2421985Domain d5jn9d_: 5jn9 D: [333780]
    automated match to d1znca_
    complexed with act, ezl, gol, so4, zn

Details for d5jn9d_

PDB Entry: 5jn9 (more details), 2.1 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and ethoxyzolamide
PDB Compounds: (D:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5jn9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jn9d_ b.74.1.1 (D:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
hwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqtw
tvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemhi
vhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttmae
sslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydke
qtvsmkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5jn9d_:

Click to download the PDB-style file with coordinates for d5jn9d_.
(The format of our PDB-style files is described here.)

Timeline for d5jn9d_: