SCOPe 2.07: Domain d5m5ec2: 5m5e C:130-225

Lineage for d5m5ec2 (5m5e C:130-225)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor common gamma chain [141041] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
   Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141

8. Domain d5m5ec2: 5m5e C:130-225 [333779]
   Other proteins in same PDB: d5m5eb1, d5m5eb2, d5m5ed_
   automated match to d2erjc2
   complexed with cys, fuc, man, nag, so4

Details for d5m5ec2

PDB Entry: 5m5e, 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor

PDB Compounds: (C:) Cytokine receptor common subunit gamma

SCOPe Domain Sequences for d5m5ec2:

Sequence; same for both SEQRES and ATOM records:

>d5m5ec2 b.1.2.1 (C:130-225) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
vipwapenltlhklsesqlelnwnnrflnhclehlvqyrtdwdhswteqsvdyrhkfslp
svdgqkrytfrvrsrfnplcgsaqhwsewshpihwg

Timeline for d5m5ec2:

• d5m5ec2 first appeared in SCOPe 2.06
  
• d5m5ec2 appears in the current release, SCOPe 2.08