Lineage for d5m5ec1 (5m5e C:33-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761714Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 2761715Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. 2761718Domain d5m5ec1: 5m5e C:33-129 [333778]
    Other proteins in same PDB: d5m5eb1, d5m5eb2, d5m5ed_
    automated match to d2erjc1
    complexed with cys, man, nag, so4

Details for d5m5ec1

PDB Entry: 5m5e (more details), 2.3 Å

PDB Description: crystal structure of a interleukin-2 variant in complex with interleukin-2 receptor
PDB Compounds: (C:) Cytokine receptor common subunit gamma

SCOPe Domain Sequences for d5m5ec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m5ec1 b.1.2.1 (C:33-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
lplpevqcfvfnveymnctwnsssepqptnltlhywyknsdndkvqkcshylfseeitsg
cqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

SCOPe Domain Coordinates for d5m5ec1:

Click to download the PDB-style file with coordinates for d5m5ec1.
(The format of our PDB-style files is described here.)

Timeline for d5m5ec1: