Lineage for d5jncc_ (5jnc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2811460Protein Carbonic anhydrase [51071] (10 species)
  7. 2812503Species Human (Homo sapiens), isozyme IV [TaxId:9606] [51076] (10 PDB entries)
  8. 2812526Domain d5jncc_: 5jnc C: [333775]
    automated match to d1znca_
    complexed with 6lh, act, gol, so4, zn

Details for d5jncc_

PDB Entry: 5jnc (more details), 2 Å

PDB Description: crystal structure for the complex of human carbonic anhydrase iv and 4-aminomethylbenzene sulfonamide
PDB Compounds: (C:) Carbonic anhydrase 4

SCOPe Domain Sequences for d5jncc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jncc_ b.74.1.1 (C:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]}
shwcyevqaessnypclvpvkwggncqkdrqspinivttkakvdkklgrfffsgydkkqt
wtvqnnghsvmmllenkasisggglpapyqakqlhlhwsdlpykgsehsldgehfamemh
ivhekekgtsrnvkeaqdpedeiavlaflveagtqvnegfqplvealsnipkpemsttma
esslldllpkeeklrhyfrylgslttptcdekvvwtvfrepiqlhreqilafsqklyydk
eqtvsmkdnvrplqqlgqrtviks

SCOPe Domain Coordinates for d5jncc_:

Click to download the PDB-style file with coordinates for d5jncc_.
(The format of our PDB-style files is described here.)

Timeline for d5jncc_: