Lineage for d5jo3b_ (5jo3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342214Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2342428Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 2342429Species Human (Homo sapiens) [TaxId:9606] [101440] (21 PDB entries)
    Uniprot O76074 534-860
  8. 2342436Domain d5jo3b_: 5jo3 B: [333772]
    automated match to d2chma1
    complexed with 6lk, zn

Details for d5jo3b_

PDB Entry: 5jo3 (more details), 1.49 Å

PDB Description: pde5a for nav1.7
PDB Compounds: (B:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5jo3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jo3b_ a.211.1.2 (B:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
hpgvsnqflintnselalmyndesvlehhhfdqclmilnspgnqilsglsieeykttlki
ikqailatdlalyikrrgeffelirknqfnledphekelflamlmtacdlsaitkpwpiq
qriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthv
sedcfplldgcrknrqkwqalae

SCOPe Domain Coordinates for d5jo3b_:

Click to download the PDB-style file with coordinates for d5jo3b_.
(The format of our PDB-style files is described here.)

Timeline for d5jo3b_: