SCOPe 2.08: Domain d5lmjc1: 5lmj C:1-112

Lineage for d5lmjc1 (5lmj C:1-112)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
Domain d5lmjc1: 5lmj C:1-112 [333766]
Other proteins in same PDB: d5lmja2, d5lmjb2, d5lmjc2, d5lmjd2
automated match to d4w81a_
complexed with po4

Details for d5lmjc1

PDB Entry: 5lmj (more details), 2.1 Å

PDB Description: llama nanobody porm_19

PDB Compounds: (C:) Nanobody

SCOPe Domain Sequences for d5lmjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lmjc1 b.1.1.1 (C:1-112) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlsctasgrtfsdydmawfrqapgkerdrvsaistkggstwy
hdsvkgrftisrdnakntvylqmnslkpedtavyycaagavtyysaryeydywgqgtqvt
vs

SCOPe Domain Coordinates for d5lmjc1:

Click to download the PDB-style file with coordinates for d5lmjc1.
(The format of our PDB-style files is described here.)

Timeline for d5lmjc1: