SCOPe 2.08: Domain d5laua1: 5lau A:1-184

Lineage for d5laua1 (5lau A:1-184)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [333701] (6 PDB entries)

8. Domain d5laua1: 5lau A:1-184 [333763]
   Other proteins in same PDB: d5laua2
   automated match to d5cb3a_
   complexed with ar6, gol; mutant

Details for d5laua1

PDB Entry: 5lau, 1.35 Å

PDB Description: oceanobacillus iheyensis macrodomain mutant g37v with adpr

PDB Compounds: (A:) macrod-type macrodomain

SCOPe Domain Sequences for d5laua1:

Sequence; same for both SEQRES and ATOM records:

>d5laua1 c.50.1.0 (A:1-184) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
mkhnindntleivvgditkettnvivnaangsllggvgvdgaihhaagpellkacqemrn
nelngeelptgeviitsgfqlpsrfiihtvgpiwnqtpdlqeellancyrnalelvkvkk
lssisfpsistgvygypiheaaaialqtiiqflqendvglvkvvlfserdysiyqeklky
liek

Timeline for d5laua1:

• d5laua1 first appeared in SCOPe 2.06
  
• d5laua1 appears in SCOPe 2.07