Lineage for d1pdoa_ (1pdo A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857339Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1857340Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 1857341Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)
  6. 1857342Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)
  7. 1857343Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)
  8. 1857344Domain d1pdoa_: 1pdo A: [33376]

Details for d1pdoa_

PDB Entry: 1pdo (more details), 1.7 Å

PDB Description: phosphoenolpyruvate-dependent phosphotransferase system
PDB Compounds: (A:) mannose permease

SCOPe Domain Sequences for d1pdoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdoa_ c.54.1.1 (A:) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

SCOPe Domain Coordinates for d1pdoa_:

Click to download the PDB-style file with coordinates for d1pdoa_.
(The format of our PDB-style files is described here.)

Timeline for d1pdoa_: