| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.54: IIA domain of mannose transporter, IIA-Man [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
Superfamily c.54.1: IIA domain of mannose transporter, IIA-Man [53062] (1 family) ![]() active dimer is formed by strand 5 swapping |
| Family c.54.1.1: IIA domain of mannose transporter, IIA-Man [53063] (1 protein) |
| Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species) |
| Species Escherichia coli [TaxId:562] [53065] (1 PDB entry) |
| Domain d1pdo__: 1pdo - [33376] |
PDB Entry: 1pdo (more details), 1.7 Å
SCOP Domain Sequences for d1pdo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdo__ c.54.1.1 (-) IIA domain of mannose transporter, IIA-Man {Escherichia coli}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk
Timeline for d1pdo__: