SCOPe 2.08: Domain d5l9qa1: 5l9q A:1-185

Lineage for d5l9qa1 (5l9q A:1-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [333701] (6 PDB entries)

8. Domain d5l9qa1: 5l9q A:1-185 [333759]
   Other proteins in same PDB: d5l9qa2, d5l9qb2
   automated match to d5cb5d_
   complexed with adp, so4

Details for d5l9qa1

PDB Entry: 5l9q, 1.75 Å

PDB Description: oceanobacillus iheyensis macrodomain with adp

PDB Compounds: (A:) macrod-type macrodomain

SCOPe Domain Sequences for d5l9qa1:

Sequence; same for both SEQRES and ATOM records:

>d5l9qa1 c.50.1.0 (A:1-185) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
mkhnindntleivvgditkettnvivnaangsllggggvdgaihhaagpellkacqemrn
nelngeelptgeviitsgfqlpsrfiihtvgpiwnqtpdlqeellancyrnalelvkvkk
lssisfpsistgvygypiheaaaialqtiiqflqendvglvkvvlfserdysiyqeklky
lieki

Timeline for d5l9qa1:

• d5l9qa1 first appeared in SCOPe 2.06
  
• d5l9qa1 appears in SCOPe 2.07