Lineage for d5jlya_ (5jly A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2134953Species Schistosoma japonicum [TaxId:6182] [225614] (7 PDB entries)
  8. 2134963Domain d5jlya_: 5jly A: [333753]
    automated match to d3ztlb_

Details for d5jlya_

PDB Entry: 5jly (more details), 3.05 Å

PDB Description: structure of peroxiredoxin-1 from schistosoma japonicum
PDB Compounds: (A:) Thioredoxin peroxidase-1

SCOPe Domain Sequences for d5jlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jlya_ c.47.1.0 (A:) automated matches {Schistosoma japonicum [TaxId: 6182]}
mvlipnkpapefhgcavidgdfkeinlkdysgkyvvlffypadftfvcpteiiafsdevd
qfksrncqviacstdskyshlawtkqdrksgglgdmriplladptksiaraygvldeeeg
nafrglfiidpkgilrqitvndkpvgrsvdetlrlldafqfvekyge

SCOPe Domain Coordinates for d5jlya_:

Click to download the PDB-style file with coordinates for d5jlya_.
(The format of our PDB-style files is described here.)

Timeline for d5jlya_: