SCOPe 2.07: Domain d1ddzb2: 1ddz B:326-564

Lineage for d1ddzb2 (1ddz B:326-564)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)

6. Protein beta-carbonic anhydrase [53058] (4 species)

7. Species Red alga (Porphyridium purpureum) [TaxId:35688] [53060] (1 PDB entry)
   duplication: consists of two similar domains

8. Domain d1ddzb2: 1ddz B:326-564 [33375]
   complexed with zn

Details for d1ddzb2

PDB Entry: 1ddz, 2.2 Å

PDB Description: x-ray structure of a beta-carbonic anhydrase from the red alga, porphyridium purpureum r-1

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d1ddzb2:

Sequence; same for both SEQRES and ATOM records:

>d1ddzb2 c.53.2.1 (B:326-564) beta-carbonic anhydrase {Red alga (Porphyridium purpureum) [TaxId: 35688]}
npnaplvqvtkggeseldstmekltaelvqqtpgklkeganrvfvnnenwrqkmlkqdpq
ffsnlahtqtpeilwigcadsrvpanqiinlpagevfvhrnianqcihsdmsflsvlqya
vqylkvkrvvvcghyacggcaaalgdsrlglidnwlrhirdvrrhnqaelsritdpkdsl
nrlieinvleqmhnvcatsivqdawdagqelevqgvvygvgdgklrdmgvvakanddig

Timeline for d1ddzb2:

• d1ddzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ddzb2 appears in SCOPe 2.06
  
• d1ddzb2 appears in the current release, SCOPe 2.08